PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0585s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 592aa    MW: 65117 Da    PI: 6.7167
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0585s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.91.6e-085105481854
                             HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  SapurV1A.0585s0110.1.p 510 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 548
                             5887779******************************88 PP

2BELL74.91.3e-24382451272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             +++l++k+++Ll ll+ Vd+rY+q+ ++++t is+F+a+++l++ +++t++Al+++S  ++ L+++i++qi
  SapurV1A.0585s0110.1.p 382 KRALEAKRTQLLALLQLVDERYSQCLDEIHTAISAFHAATELDP-QIHTRFALQTVSLLYKRLREQISNQI 451
                             6899****************************************.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.0E-21303449IPR006563POX domain
PfamPF075261.9E-25308448IPR006563POX domain
PROSITE profilePS5007111.029489552IPR001356Homeobox domain
SMARTSM003896.9E-6492556IPR001356Homeobox domain
CDDcd000863.96E-11492553No hitNo description
SuperFamilySSF466892.69E-15494561IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-26495558IPR009057Homeodomain-like
PfamPF059209.5E-15509548IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MENGLFSVPI DMAGRNSVTM DCSSQRAPNS LVQLDSFNLN HHNQTLVGFS MLPTLQGEPI  60
SDLHANVHMA NRSSFMNSDA LVASFGRNVV GDALPGCSRS AGNTPFEEQF GGGISDYALA  120
TLVDIRSGLQ ENLNNLAISG PSSYPLEELR SFVSNDCTNA SISSLPSSLN YGCGEVFGSA  180
NGKEDFDRFP TSRELGGRAP LRAGFQPHLS IGNLQPNDWT ACNGVNVSED EPFASGKLAN  240
ELSLSLATSQ PSVMDSRSIP DQCSDITYNH AARHFSKETR LGSEQTSCSR KDLSLSCSSY  300
KTGQSSQVLL GSRYLHVIQE ILAQIASYSL GNLDQVRSST AGFKTGASTL FSSSYAMEGG  360
APPMGFDKSP GLDVQMDPAL QKRALEAKRT QLLALLQLVD ERYSQCLDEI HTAISAFHAA  420
TELDPQIHTR FALQTVSLLY KRLREQISNQ ILAMGAHLDS GDTIETEGSV ETSYLQKQWT  480
LQQLKKNEHQ LWRPQRGLPE RSVSVLRAWM FQNFLHPYPK DAEKHLLAVK SGLTRSQVSN  540
WFINARVRLW KPMIEEMYAE MNRRKGRQNE EGANRNHRGL ISINNPRFNV S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A5e-15498556563Homeobox protein Meis2
4xrm_B5e-15498556563Homeobox protein Meis2
4xrs_A4e-15498555158Homeobox protein Meis1
4xrs_B4e-15498555158Homeobox protein Meis1
5bng_A5e-15498556159Homeobox protein Meis2
5bng_B5e-15498556159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3759671e-65AF375967.1 Lycopersicon esculentum bell-like homeodomain protein 4 (BL4) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324760.20.0hypothetical protein POPTR_0018s05080g
SwissprotP487311e-117ATH1_ARATH; Homeobox protein ATH1
TrEMBLB9INJ20.0B9INJ2_POPTR; Uncharacterized protein
STRINGPOPTR_0018s05080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59393249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-113homeobox gene 1